This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
NOTCH1 Polyclonal Antibody
catalog :
PA5-95461
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
Product Type :
Antibody
Product Name :
NOTCH1 Polyclonal Antibody
Catalog # :
PA5-95461
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse
Isotype :
IgG
Storage :
-20 C
Description :
The notch gene belongs to a family of epidermal growth factor (EGF) like homeotic genes, which encode transmembrane proteins with a variable number of cysteine-rich EGF-like repeats in the extracellular region. Four notch genes have been described in mammals: Notch1, Notch2, Notch3 and Notch4(Int-3), which have been implicated in the differentiation of the nervous system and other structures. The EGF-like proteins Delta and Serrate have been identified as ligands of Notch1. Mature Notch proteins are heterodimeric receptors derived from the cleavage of Notch pre-proteins into an extracellular subunit (NEC) containing multiple EGF-like repeats and a transmembrane subunit including intracellular region (Ntm).
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Notch1 (1797-1827aa LKNASDGALMDDNQNEWGDEDLETKKFRFEE).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
9930111A19Rik; AOS5; AOVD1; Drosophila Notch homolog 1 (controlling the the ectodermal and neural cell fate in Drosophila); hN1; lin-12; major type A protein; Mis6; Motch; Motch A; mT14; N1; neurogenic locus notch homolog protein 1; NEXT; NICD; NOTCH; notch 1; Notch 1 extracellular truncation; Notch 1 intracellular domain; Notch gene homolog 1; Notch homolog 1, translocation-associated; notch receptor 1; Notch1; p300; RP23-306D20.12; RP23-306D20.12-001; Tan1; Translocation-associated notch protein TAN-1; transmembrane receptor Notch1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments