This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Lyn Polyclonal Antibody
catalog :
PA5-95460
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
Lyn Polyclonal Antibody
Catalog # :
PA5-95460
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Lyn proto oncogene (Lcl/Yes related novel protein tyrosine kinase) is encoded by the Lyn gene located on chromosome 8 in humans and belongs to the Src family kinase. It is a non-receptor tyrosine kinase that acts as a mediator in transducing cellular signaling. The most well studied expression of Lyn is in hematopoietic cell types, both lymphoid and myeloid cells with exclusion in T lymphocytes. It has also been observed that Lyn plays diverse roles such as in regulation of B cell receptor signaling, mast cell signaling and Epithelial - Mesenchymal Transition (EMT).
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Lyn (470-501aa DELYDIMKMCWKEKAEERPTFDYLQSVLDDFY).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AA407514; CD180; CD180 antigen; CD180 molecule; CH73-38P6.3; FLJ26625; Hck-2; JTK8; lck/Yes-related novel protein tyrosine kinase; LY64; Ly78; lymphocyte antigen 64; lymphocyte antigen-64, radioprotective, 105kDa; LYN; lyn protein non-receptor kinase; lyn protein tyrosine kinase; LYN proto-oncogene, Src family tyrosine kinase; p53Lyn; p56Lyn; Radioprotective 105 kDa protein; RP105; Tyrosine-protein kinase Lyn; v-yes-1 Yamaguchi sarcoma viral related oncogene homolog; v-yes-1 Yamaguchi sarcoma viral related oncogene protein-like protein; Yamaguchi sarcoma viral (v-yes-1) oncogene homolog; zgc:92124
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments