This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
TIMP3 Polyclonal Antibody
catalog :
PA5-95446
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, ELISA
product information
Product Type :
Antibody
Product Name :
TIMP3 Polyclonal Antibody
Catalog # :
PA5-95446
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Tissue inhibitor of metalloproteinase 3 (TIMP3) is a member of the tissue inhibitor of metalloproteinases gene family. It functions to inhibit the activity of matrix metalloproteinases (MMP) which degrade components of the extracellular matrix. TIMP3 is expressed upon mitogenic stimulation. It binds irreversibly to zinc-dependent MMPs and inactivates them by binding to their catalytic zinc cofactor. Other functions of TIMP3 include nervous system development, tissue regeneration, and visual perception. In humans, the gene encoding TIMP3 is located on chromosome 22.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human TIMP3 (107-141aa RVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHL).
Format :
Lyophilized
Applications w/Dilutions :
ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG-5 protein; protein MIG-5; SFD; Sun; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP metallopeptidase inhibitor 3 (Sorsby fundus dystrophy, pseudoinflammatory); TIMP metallopeptidase inhibitor 3 L homeolog; timp3; TIMP-3; TIMP-3 protein; timp3.L; timp3-A; tissue inhibitor metalloproteinase-3; tissue inhibitor of metalloproteinase 3; tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, pseudoinflammatory); tissue inhibitor of metalloproteinase-3; tissue inhibitor of metalloproteinase-3 precursor; tissue inhibitor of metalloproteinases 3; tissue inhibitor of metalloproteinases-3; XELAEV_18002484mg
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments