TFPI2 Polyclonal Antibody | Invitrogen PA5-95444 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

TFPI2 Polyclonal Antibody

catalog :

PA5-95444

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

Product Type :

Antibody

Product Name :

TFPI2 Polyclonal Antibody

Catalog # :

PA5-95444

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse

Isotype :

IgG

Storage :

-20 C

Description :

TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2 (70-105aa EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

AV000670; Placental protein 5; PP5; PP5/TFPI-2; PP5FLJ21164; REF1; REF-1; retinal pigment epithelium cell factor 1; TFPI2; TFPI-2; TFPI-2REF1; Tissue factor pathway inhibitor 2