This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
S6 Polyclonal Antibody
catalog :
PA5-95440
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
S6 Polyclonal Antibody
Catalog # :
PA5-95440
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Immunogen :
QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVR
I).
A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
(Rp)S6; 40S ribosomal protein S6; air[8]; air8; anon-WO02059370.61; CG10944; CG10944-PA; CG10944-PB; Dmel CG10944; Dmel_CG10944; DS6; hemocytes enlarged; hen; l(1)air[8]; l(1)air8; l(1)hen; LD31286p; lethal(1)aberrant immune response[8]; lethal-(1)-haemocytes enlarged; lethal-aberrant-immune-response-8; M(1)7BC; M(1)7C; minute; minute (1) 7BC; OK/SW-cl.2; OTTHUMP00000021121; OTTHUMP00000021122; Phosphoprotein NP33; pp30; ribosomal protein S6; Rp S6; RP11-513M16.6; RPS6; RpS6-PA; RpS6-PB; RS6; S6; S6 ribosomal protein; S6R; Small ribosomal subunit protein eS6; wu:fa92e06; wu:fb64g06; zgc:92237
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA