This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PDGF-B Polyclonal Antibody
catalog :
PA5-95438
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
PDGF-B Polyclonal Antibody
Catalog # :
PA5-95438
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.
Immunogen :
AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEV
QR).
A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
becaplermin; c-sis; I79_017626; IBGC5; PDGF; pdgf protein; PDGF subunit B; PDGF, B chain; PDGF2; PDGF-2; Pdgfb; PDGF-B; platelet derived growth factor subunit B; platelet derived growth factor, B polypeptide; platelet-derived growth factor 2; platelet-derived growth factor B; platelet-derived growth factor B chain; platelet-derived growth factor B subunit; platelet-derived growth factor beta; platelet-derived growth factor beta isoform 1, preproprotein; platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); Platelet-derived growth factor subunit B; platelet-derived growth factor, beta polypeptide (oncogene SIS); Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); proto-oncogene c-Sis; Sis; SSV; v-sis platelet-derived growth factor beta polypeptide (simian sarcoma viral oncogene homolog)
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA