This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
DEFA1 Polyclonal Antibody
catalog :
PA5-95414
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
DEFA1 Polyclonal Antibody
Catalog # :
PA5-95414
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Defensins are a family of microbicidal and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
alpha-defensin 1; Cryptdin-1; DEF1; Defa1; DEFA1B; DEFA2; Defcr; Defcr1; defensin alpha 1; defensin related cryptdin peptide 1; defensin, alpha 1; defensin, alpha 1, myeloid-related sequence; defensin, alpha 2; defensin-1; defensin-related cryptdin peptide; HNP-1; HNP-2; HP 1-56; HP1; HP-1; HP-2; MRS; myeloid-related sequence; neutrophil defensin 1; Neutrophil defensin 2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA