This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ST7 Polyclonal Antibody
catalog :
PA5-95405
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry, flow cytometry
product information
Product Type :
Antibody
Product Name :
ST7 Polyclonal Antibody
Catalog # :
PA5-95405
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.
Immunogen :
DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCA
RRL).
A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa
RRL).
A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
4low density lipoprotein-related protein 12; 9430001H04Rik; ETS7q; FAM4A; FAM4A1; Fam4a2; family with sequence similarity 4, subfamily A, member 1; family with sequence similarity 4, subfamily A, member 2; HELG; mRay; Protein FAM4A1; Protein HELG; RAY1; SEN4; St7; suppression of tumorigenicity 7; suppression of tumorigenicity 7 (breast); suppressor of tumorigenicity 7 protein; TSG7
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments