ST7 Polyclonal Antibody | Invitrogen PA5-95405 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

ST7 Polyclonal Antibody

catalog :

PA5-95405

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry

product information

Product Type :

Antibody

Product Name :

ST7 Polyclonal Antibody

Catalog # :

PA5-95405

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.

Immunogen :

DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCA
RRL).
A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

4low density lipoprotein-related protein 12; 9430001H04Rik; ETS7q; FAM4A; FAM4A1; Fam4a2; family with sequence similarity 4, subfamily A, member 1; family with sequence similarity 4, subfamily A, member 2; HELG; mRay; Protein FAM4A1; Protein HELG; RAY1; SEN4; St7; suppression of tumorigenicity 7; suppression of tumorigenicity 7 (breast); suppressor of tumorigenicity 7 protein; TSG7