This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
MMP13 Polyclonal Antibody
catalog :
PA5-95401
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
Product Type :
Antibody
Product Name :
MMP13 Polyclonal Antibody
Catalog # :
PA5-95401
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Non-human primate
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Non-human primate
Isotype :
IgG
Storage :
-20 C
Description :
MMP13 (collagense 3) plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC, and ACAN. MMP13 cleaves tripal helical collagens, including type I, II, and III collagen - but has the highest activity with soluble type II collagen. It can degrade collagen type IV, XIV, and X. MMP13 plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization, and ossification. It is required for normal embryonic bone development and ossificaiton. Mutations affecting the gene can lead to spondyloepimetaphyseal dysplasia Missouri type, metaphyseal anadysplasia 1, and metaphyseal dysplasia Sphar type.
Immunogen :
RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSD
VTPLNFT).
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa
VTPLNFT).
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
cb1034; Clg; CLG3; Collagenase; collagenase 3; collagenase 3a; matrix metalloproteinase 13a; collagenase-1; Collagenase3; Collagenase-3; collagenase-3 precursor; interstitial collagenase; MANDP1; matrix metallo protease; matrix metallopeptidase 13; matrix metallopeptidase 13 (collagenase 3); matrix metallopeptidase 13a; matrix metallopeptidase 13a (collagenase 3); matrix metalloproteinase 13; matrix metalloproteinase 13 (collagenase 3); matrix metalloproteinase-13; matrix metalloproteinase-13; MMP-13; interstitial protein; MMP; Mmp1; MMP13; MMP-13; mmp13 protein; mmp13a; MMPLg; MMPLh; MMPs; Procollagenase 3; UMRCASE; ZFMMP13
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments