MMP13 Polyclonal Antibody | Invitrogen PA5-95401 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

MMP13 Polyclonal Antibody

catalog :

PA5-95401

quantity :

100 ug

price :

US 464.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

Product Type :

Antibody

Product Name :

MMP13 Polyclonal Antibody

Catalog # :

PA5-95401

Quantity :

100 ug

Price :

US 464.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Non-human primate

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Non-human primate

Isotype :

IgG

Storage :

-20 C

Description :

MMP13 (collagense 3) plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC, and ACAN. MMP13 cleaves tripal helical collagens, including type I, II, and III collagen - but has the highest activity with soluble type II collagen. It can degrade collagen type IV, XIV, and X. MMP13 plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization, and ossification. It is required for normal embryonic bone development and ossificaiton. Mutations affecting the gene can lead to spondyloepimetaphyseal dysplasia Missouri type, metaphyseal anadysplasia 1, and metaphyseal dysplasia Sphar type.

Immunogen :

RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSD
VTPLNFT).
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

cb1034; Clg; CLG3; Collagenase; collagenase 3; collagenase 3a; matrix metalloproteinase 13a; collagenase-1; Collagenase3; Collagenase-3; collagenase-3 precursor; interstitial collagenase; MANDP1; matrix metallo protease; matrix metallopeptidase 13; matrix metallopeptidase 13 (collagenase 3); matrix metallopeptidase 13a; matrix metallopeptidase 13a (collagenase 3); matrix metalloproteinase 13; matrix metalloproteinase 13 (collagenase 3); matrix metalloproteinase-13; matrix metalloproteinase-13; MMP-13; interstitial protein; MMP; Mmp1; MMP13; MMP-13; mmp13 protein; mmp13a; MMPLg; MMPLh; MMPs; Procollagenase 3; UMRCASE; ZFMMP13