This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
KCNQ1 Polyclonal Antibody
catalog :
PA5-95399
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
KCNQ1 Polyclonal Antibody
Catalog # :
PA5-95399
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Voltage-gated K+ channels in the plasma membrane control the repolarization and the frequency of action potentials in neurons, muscles and other excitable cells. A specific K+ channel, comprised of an alpha subunit KCNQ1 and a beta subunit KCNE1, a small protein which spans the membrane only once, is predominantly expressed in the heart and in the cochlea, and is responsible for regulating the slow, depolarization-activated potassium current. Mutations in the genes encoding for KCNQ1 and KCNE1 lead to cardiac disease because they directly impair electrical signaling, and mutations in KCNQ4 are implicated in the onset of deafness. KCNQ proteins, including KCNQ1 and KCNQ4, characteristically contain six transmembrane domains and function as tetramers. KCNQ4 forms heteromeric channels with KCNQ3 and is expressed in several tissues, including the cochlea, where it is present in outer hair cells.
Immunogen :
QQKQRQKHFNRQIPAAASLIQTAWRCYAAENPDSSTWKI
YIR).
A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa
YIR).
A synthetic peptide corresponding to a sequence in the middle region of human KCNQ1 (356-397aa
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
ATFB1; ATFB3; AW559127; FLJ26167; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; JLNS1; KCNA8; KCNA9; Kcnq1; kidney and cardiac voltage dependend K+ channel; KQT-like 1; Kv1.9; Kv7.1; KVLQT1; LQT; LQT1; mutant potassium voltage-gated channel KQT-like subfamily member 1; potassium channel, voltage gated KQT-like subfamily Q, member 1; potassium channel, voltage-gated KQT-like subfamily Q, member 1; potassium voltage-gated channel subfamily KQT member 1; potassium voltage-gated channel subfamily Q member 1; potassium voltage-gated channel, KQT-like subfamily, member 1; potassium voltage-gated channel, subfamily Q, member 1; RWS; slow delayed rectifier channel subunit; SQT2; voltage-gated potassium channel subunit Kv7.1; WRS
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
