This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CYP17A1 Polyclonal Antibody
catalog :
PA5-95393
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CYP17A1 Polyclonal Antibody
Catalog # :
PA5-95393
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
17a-hydroxylase; 17-alpha-hydroxyprogesterone aldolase; CPT7; Cyp17; Cyp17a1; CYPXVII; cytochrome P450 17A1; cytochrome P450 family 17 subfamily A member 1; cytochrome p450 XVIIA1; cytochrome P450, 17; cytochrome P450, 17a1; cytochrome P450, family 17, subfamily A, polypeptide 1; cytochrome P450, subfamily 17; Cytochrome P450, subfamily XVII; cytochrome P450, subfamily XVII (steroid 17-alpha-hydroxylase), adrenal hyperplasia; Cytochrome P450c17; cytochrome P450-C17; HGNC:2593; P45017alpha; p450c17; P450-C17; S17AH; steroid 17-alpha hydroxylase; steroid 17-alpha-hydroxylase/17,20 lyase; Steroid 17-alpha-monooxygenase
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA