This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
AP2M1 Polyclonal Antibody
catalog :
PA5-95390
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
AP2M1 Polyclonal Antibody
Catalog # :
PA5-95390
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The heterotetrameric coat assembly protein complex, also known as the adaptor-related protein complex 2 (AP-2), belongs to the adaptor complexes medium subunits family. The mu 1 subunit of the AP-2 complex (AP2M1) is required for the activity of a vacuolar ATPase, which is responsible for proton pumping occurring in the acidification of endosomes and lysosomes. AP2M1 has also been shown to associate with the HIV-1 protein Nef, suggesting that Nef may use AP-2 complex to enhance the rate of endocytosis of both CD4 and class I MHC. AP2M1 may also play an important role in regulating the intracellular trafficking and function of cytotoxic T-lymphocyte associated (CTLA)-4 protein. At least two isoforms of AP2M1 are known to exist.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human AP2M1 (399-435aa LKVRYLKVFEPKLNYSDHDVIKWVRYIGRSGIYETRC).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
adapter-related protein complex 2 mu subunit; adapter-related protein complex 2 subunit mu; adaptin-mu2; Adaptor protein complex AP-2 subunit mu; adaptor related protein complex 2 mu 1 subunit; adaptor related protein complex 2 subunit mu 1; adaptor related protein complex 2, mu 1 subunit; adaptor-related protein complex 2 subunit mu; adaptor-related protein complex 2, mu 1 subunit; AP-2 complex subunit mu; AP-2 mu 2 chain; AP-2 mu chain; Ap2m1; AP50; Clapm1; clathrin adaptor complex AP2, mu subunit; Clathrin assembly protein complex 2 medium chain; clathrin assembly protein complex 2 mu medium chain; clathrin coat adaptor protein AP50; Clathrin coat assembly protein AP50; Clathrin coat-associated protein AP50; clathrin-associated/assembly/adaptor protein, medium 1; coat assembly protein complex 50 kD; HA2 50 kDA subunit; KIAA0109; mu2; Mu2-adaptin; Plasma membrane adaptor AP-2 50 kDa protein; plasma membrane adaptor AP-2 50kDA protein; QtsA-16673; unnamed protein product
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
