DDAH1 Polyclonal Antibody | Invitrogen PA5-95366 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

DDAH1 Polyclonal Antibody

catalog :

PA5-95366

quantity :

100 ug

price :

US 454.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

citations: 1

Reference
Hannemann J, Glatzel A, Hillig J, Zummack J, Schumacher U, Lüneburg N, et al. Upregulation of DDAH2 Limits Pulmonary Hypertension and Right Ventricular Hypertrophy During Chronic Hypoxia in Ddah1 Knockout Mice. Front Physiol. 2020;11:597559 pubmed publisher

product information

Product Type :

Antibody

Product Name :

DDAH1 Polyclonal Antibody

Catalog # :

PA5-95366

Quantity :

100 ug

Price :

US 454.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

2410006N07Rik; 2510015N06Rik; AI987801; AW050362; Ddah; Ddah1; DDAH-1; DDAHI; dimethylargininase-1; dimethylarginine dimethylaminohydrolase 1; epididymis secretory protein Li 16; FLJ21264; FLJ25539; HEL-S-16; N(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG, NG-dimethylarginine dimethylaminohydrolase; NG,NG dimethylarginine dimethylaminohydrolase; RP4-621F18.1