This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
AMACR Polyclonal Antibody
catalog :
PA5-95365
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
AMACR Polyclonal Antibody
Catalog # :
PA5-95365
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
P504S/AMACR/a-Methylacyl-CoA Racemase is an essential enzyme in the b-oxidation of branched-chain fatty acids. High expression of P504S protein is found in prostatic adenocarcinoma but not in benign prostate tissue by immunohistochemical staining in paraffin-embedded tissue. The expression of P504S is also detected in two premalignant lesions of the prostate: high-grade prostatic intraepithelial neoplasia (PIN) and atypical adenomatous hyperplasia.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2-arylpropionyl-CoA epimerase; 2-methylacyl-CoA racemase; Alpha-methylacyl-CoA racemase; alpha-methylacyl-Coenzyme A racemase; Amacr; AMACRD; amcr; CBAS4; Da1-8; Macr1; Marc1; OTTHUMP00000219978; OTTHUMP00000219979; RACE; RM
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA