This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
ABCB10 Polyclonal Antibody
catalog :
PA5-95361
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
ABCB10 Polyclonal Antibody
Catalog # :
PA5-95361
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
ABC transporter 10 protein; ABCB10; Abcb12; Abc-me; ABC-me protein; ABC-mitochondrial erythroid protein; ATP binding cassette subfamily B member 10; ATP-binding cassette sub-family B member 10, mitochondrial; ATP-binding cassette transporter 10; ATP-binding cassette, subfamily B (MDR/TAP), member 10; ATP-binding cassette, sub-family B (MDR/TAP), member 10; EST20237; M-ABC2; mitochondrial ATP-binding cassette 2; MTABC2; si:dkey-162b3.3
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA