This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Galectin 4 Polyclonal Antibody
catalog :
PA5-95353
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, flow cytometry
product information
Product Type :
Antibody
Product Name :
Galectin 4 Polyclonal Antibody
Catalog # :
PA5-95353
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. Galectin 4 binds lactose and a related range of sugars. May be involved in the assembly of adherens junctions.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
Antigen NY-CO-27; GAL4; gal-4; galectin 4; galectin-4; L-36; L-36 lactose-binding protein; L36LBI; L36LBP; lactose-binding lectin 4; Lectin galactose binding soluble 4 (Galectin-4); lectin, galactose binding, soluble 4; Lectin, galactose binding, soluble 4 (Galectin-4); lectin, galactoside binding soluble 4; lectin, galactoside-binding, soluble, 4; lectin, galactoside-binding, soluble, 4 (galectin 4); Lgals4
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
