This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Bcl-X Polyclonal Antibody
catalog :
PA5-95348
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - frozen section
product information
Product Type :
Antibody
Product Name :
Bcl-X Polyclonal Antibody
Catalog # :
PA5-95348
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded the BCL-X gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform acts as an apoptotic inhibitor and the shorter isoform acts as an apoptotic activator.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/mL, Immunohistochemistry (Frozen): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
anti-apoptosis regulatory protein; anti-apoptotic Bcl-2 gene family member; anti-apoptotic Bcl-xL; anti-apoptotic regulator Bcl-xL; apoptosis regulator Bcl-X; B cell lymphoma 2 like; B cell lymphoma like X; B-cell leukemia/lymphoma x; Bcl 2 like 1; bcl x; Bcl xL; BCL XL/S; Bcl(X)L; bcl-2 L1; BCL2 like 1; BCL2L; Bcl2l1; bcl2-L-1; BCL2-like 1; Bcl-2-like protein 1; BCL2-like protein 1; BCLX; bcl-x; Bcl-x long protein; BclxL; Bcl-xL; BCL-XL/S; BclXS; bcl-xS; BLC2L; DKFZp781P2092; PPP1R52; protein phosphatase 1, regulatory subunit 52; RP5-857M17.3; unnamed protein product
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
