This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
UBE1 Polyclonal Antibody
catalog :
PA5-95346
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
UBE1 Polyclonal Antibody
Catalog # :
PA5-95346
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
UBE1 catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11. 23. Alternative splicing results in 2 transcript variants encoding the same protein, but with different 5' UTR.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1 (102-139aa HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
A1S9; A1S9 protein; A1S9T; A1S9T and BN75 temperature sensitivity complementing; A1ST; AMCX1; CFAP124; EMBL:AAH85791.1, ECO:0000312; GXP1; POC20; POC20 centriolar protein homolog; Protein A1S9; RGD:1359327}; Sbx; SMAX2; testicular secretory protein Li 63; Uba1; uba1 {ECO:0000312; UBA1, ubiquitin-activating enzyme E1 homolog A; UBA1A; UBE1; Ube-1; Ube1ax; Ube1x; ubiquitin like modifier activating enzyme 1; Ubiquitin-activating enzyme E1; ubiquitin-activating enzyme E1 {ECO:0000250; Ubiquitin-activating enzyme E1 X; ubiquitin-activating enzyme E1, Chr X; ubiquitin-like modifier activating enzyme 1; ubiquitin-like modifier-activating enzyme 1; ubiquitin-like modifier-activating enzyme 1 {ECO:0000250; Ubiquitin-like modifier-activating enzyme 1 X; UniProtKB:Q02053}
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments