UNC5C Polyclonal Antibody | Invitrogen PA5-95332 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

UNC5C Polyclonal Antibody

catalog :

PA5-95332

quantity :

100 ug

price :

US 474.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry

product information

Product Type :

Antibody

Product Name :

UNC5C Polyclonal Antibody

Catalog # :

PA5-95332

Quantity :

100 ug

Price :

US 474.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin -like domains and 2 type I thrombospondin motifs in the extracellular region.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL

Aliases :

B130051O18Rik; Netrin receptor UNC5C; protein unc-5 homolog 3; Protein unc-5 homolog C; Rcm; Rostral cerebellar malformation protein; unc5 (C.elegans homolog) c; unc5 homolog 3; UNC-5 homolog 3; unc-5 homolog C; unc-5 homolog C (C. elegans); unc-5 netrin receptor C; UNC5C; UNC5H3