This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SULT2A1 Polyclonal Antibody
catalog :
PA5-95329
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
SULT2A1 Polyclonal Antibody
Catalog # :
PA5-95329
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
SULT1 sulfotransferases exhibit N-sulfating activities of carcinogenic heterocyclic amines, and are selective toward phenols, whereas SULT2 enzymes prefer hydroxysteroids and SULT3 family members are selective for N-substituted aryl and alicyclic compounds. SULT2A1 catalyzes the sulfonation of procarcinogen xenobiotics, hydroxysteroids and bile acids, and is highly expressed in adrenal and liver tissues. SULT2A1 plays a role in hepatic cholesterol homeostasis. SULT2B1 consists of two isoforms, SULT2B1a and SULT2B1b, which are transcribed from the same gene by alternative splicing of their first exons. Both isoforms are highly selective for the sulphation of 3b-hydroxysteroids such as pregnenolone, epiandrosterone, DHEA and androstenediol. SULT2B1b is expressed in prostate, skin, placenta and lung.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
alcohol sulfotransferase; alcohol/hydroxysteroid sulfotransferase; bile salt sulfotransferase; Bile salt sulfotransferase 1; bile-salt sulfotranasferase 2A1; bile-salt sulfotransferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEAS; DHEA-ST; HST; hSTa; Hydroxysteroid sulfotransferase; hydroxysteroid sulfotransferase a; mSTa1; Smp-2; ST; ST2; ST-20; ST2A1; ST2A3; STa; Sta1; Std; Sth1; Sth2; Sulfotransferase 2A1; sulfotransferase family 2A member 1; sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA) -preferring, member 1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1; sulfotransferase hydroxysteroid gene 2; sulfotransferase, DHEA preferring; sulfotransferase, hydroxysteroid preferring 1; sulfotransferase, hydroxysteroid preferring 2; SULT2A1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA