This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD19 Polyclonal Antibody
catalog :
PA5-95326
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CD19 Polyclonal Antibody
Catalog # :
PA5-95326
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
CD19 is a member of the immunoglobulin superfamily and has two Ig like domains. The CD19 molecule is expressed on 100% of the peripheral B cells as defined by expression of kappa or lambda light chains. CD19 appears to be expressed on myeloid leukemia cells, particularly those of monocytic lineage. Leukemia phenotype studies have demonstrated that the earliest and broadest B cell restricted antigen is the CD19 antigen. The receptor for CD19 is an important functional regulator of normal and malignant B cell proliferation, and is expressed in all B cell precursor leukemias. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. CD19 is a cell surface molecule which assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Besides being a signal-amplifying coreceptor for the B cell receptor (BCR), CD19 can also signal independently of BCR co-ligation and is a central regulatory component upon which multiple signaling pathways converge. Mutation of the CD19 gene results in hypogammaglobulinemia, whereas CD19 overexpression causes B cell hyperactivity.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
AW495831; B4; B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; Cd19; CD19 antigen; CD19 molecule; CVID3; differentiation antigen CD19; Leu-12; T-cell surface antigen Leu-12
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments