This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
PCSK6 Polyclonal Antibody
catalog :
PA5-95320
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
PCSK6 Polyclonal Antibody
Catalog # :
PA5-95320
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human PACE4 (614-651aa RNPEKQGKLKEWSLILYGTAEHPYHTFSAHQSRSRMLE).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
C86343; im:7140527; kexin-like protease PC7A; PACE4; Paired basic amino acid cleaving enzyme 4; paired basic amino acid cleaving system 4; Pcsk6; Proprotein convertase subtilisin/kexin type 6; SPC4; Subtilisin - like endoprotease; Subtilisin/kexin-like protease PACE4; subtilisin-like proprotein convertase 4
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments