This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
AMPK beta-1 Polyclonal Antibody
catalog :
PA5-95312
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
AMPK beta-1 Polyclonal Antibody
Catalog # :
PA5-95312
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
AMPK beta 1 is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. The myristoylation and phosphorylation of this subunit have been shown to affect the enzyme activity and cellular localization of AMPK. This subunit may also serve as an adaptor molecule mediating the association of the AMPK complex.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human AMPK beta 1 (32-68aa DRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLE).
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
1300015D22Rik; 5'-AMP-activated protein kinase 40 kDa subunit; 5-AMP-activated protein kinase beta subunit; 5'-AMP-activated protein kinase beta-1 subunit; 5'-AMP-activated protein kinase subunit beta-1; 5'-AMP-activated protein kinase subunit beta-1-like protein; 5'-AMP-activated protein kinase, beta subunit; AAKB1; AMP-activated protein kinase beta subunit; AMPK; AMPK beta 1; AMPK beta -1 chain; AMPK beta-1 chain; AMPK subunit beta-1; AMPKb; AMPK-beta1; AU021155; E430008F22; HAMPKb; kinase AMPK-beta1; kinase pAMPK; pAMPK; Prkab1; protein kinase AMP-activated non-catalytic subunit beta 1; protein kinase, AMP-activated, beta 1 non-catalytic subunit; protein kinase, AMP-activated, noncatalytic, beta-1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
