This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
LOXL2 Polyclonal Antibody
catalog :
PA5-95306
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
LOXL2 Polyclonal Antibody
Catalog # :
PA5-95306
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human LOXL2 (739-770aa HRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
1110004B06Rik; 4930526G11Rik; 9430067E15Rik; LOR2; Loxl2; Lysyl oxidase homolog 2; lysyl oxidase homolog 2; LOW QUALITY PROTEIN: lysyl oxidase homolog 2; lysyl oxidase like 2; lysyl oxidase related 2; lysyl oxidase-like 2; lysyl oxidase-like 2 delta e13; lysyl oxidase-like 2 protein; lysyl oxidase-like protein 2; Lysyl oxidase-related protein 2; lysyl oxidase-related protein WS9-14; WS9-14
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments