This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
GRK3 Polyclonal Antibody
catalog :
PA5-95301
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunocytochemistry, flow cytometry
product information
Product Type :
Antibody
Product Name :
GRK3 Polyclonal Antibody
Catalog # :
PA5-95301
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
ADRBK2, or adrenergic beta receptor kinase 2 is a serine/threonine kinase that is thought to act as a regulator of receptor function. Overall, the ADRBK2 enzyme, also known as GRK3, has 85% amino acid similarity with ADRBK1, with the protein kinase catalytic domain having 95% similarity. The ADRBK2 mRNA is approximately 8 kilobases with a distribution similar to that of ADRBK1. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GRK3 (635-669aa ESDPEFVQWKKELNETFKEAQRLLRRAPKFLNKPR).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
4833444A01Rik; ADRBK2; Adrbk-2; adrenergic receptor kinase, beta 2; adrenergic receptor kinase, beta 2 (G-protein-linked receptor kinase); adrenergic, beta, receptor kinase 2; AI851927; AW551196; BARK2; Bark-2; beta ARK2; beta-adrenergic receptor kinase 2; Beta-ARK-2; G protein-coupled receptor kinase 3; G-protein-coupled receptor kinase 3; Grk3
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments