This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Galectin 8 Polyclonal Antibody
catalog :
PA5-95297
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
Galectin 8 Polyclonal Antibody
Catalog # :
PA5-95297
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
1200015E08Rik; 30 kDa S-type lectin; AI326142; D13Ertd524e; Gal-8; galectin 8; galectin-8; galectin-8g; galectin-8L; lectin, galactose binding, soluble 5; lectin, galactose binding, soluble 8; lectin, galactoside binding soluble 8; lectin, galactoside-binding, soluble, 8; LGALS8; Lgals-8; PCTA1; PCTA-1; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; Po66-CBP; prostate carcinoma tumor antigen 1; RL-30; RP11-385F5.1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments