This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
LCAT Polyclonal Antibody
catalog :
PA5-95296
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
LCAT Polyclonal Antibody
Catalog # :
PA5-95296
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Lecithin: cholesterol acyltransferase (LCAT) is the plasma enzyme responsible for most HDL cholesteryl esters in human plasma. In species with cholesteryl ester transfer protein (CETP) it is also responsible for a significant proportion of VLDL and LDL cholesteryl esters. LCAT, through the esterification of cholesterol, plays a role in the reverse cholesterol transport pathway by facilitating the net movement of cholesterol from peripheral tissues back to the liver for excretion. LCAT deficiency results in low levels of plasma HDL, whereas a transgenic overexpression of LCAT results in increased plasma HDL concentrations.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
AI046659; D8Wsu61e; Lcat; lecithin cholesterol acyltransferase; lecithin-cholesterol acyltransferase; lecithin-cholesterol acyltransferase Lcat; phosphatidylcholine-sterol acyltransferase; phosphatidylcholine--sterol O-acyltransferase; Phospholipid-cholesterol acyltransferase; testicular secretory protein Li 24
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA