This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
IKAROS Polyclonal Antibody
catalog :
PA5-95293
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
IKAROS Polyclonal Antibody
Catalog # :
PA5-95293
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
DNA-binding protein IKAROS functions in the specification and the maturation of the T lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyl transferase promoter as well as with the promoters for other genes expressed during early stages of B-cell and T-cell development.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
5832432G11Rik; CLL-associated antigen KW-6; CVID13; DNA-binding protein Ikaros; hIk-1; hlk-1; Hs.54452; IK1; IKAROS; IKAROS family zinc finger 1; IKAROS family zinc finger 1 (Ikaros); ikaros family zinc finger protein 1; IKZF1; KAROS family zinc finger 1 (Ikaros); LYF1; LyF-1; Lymphoid transcription factor LyF-1; mKIAA4227; PPP1R92; PRO0758; protein phosphatase 1, regulatory subunit 92; RGD1562979; Zfpn1a1; zinc finger containing transcription factor; zinc finger protein, subfamily 1A, 1 (Ikaros); Znfn1a1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
