This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
FMO1 Polyclonal Antibody
catalog :
PA5-95285
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
citations: 2
Reference
Wang L, Zha H, Huang J, Shi L. Flavin containing monooxygenase 2 regulates renal tubular cell fibrosis and paracrine secretion via SMURF2 in AKI‑CKD transformation. Int J Mol Med. 2023;52: pubmed publisher
Huang S, Howington M, Dobry C, Evans C, Leiser S. Flavin-Containing Monooxygenases Are Conserved Regulators of Stress Resistance and Metabolism. Front Cell Dev Biol. 2021;9:630188 pubmed publisher
product information
Product Type :
Antibody
Product Name :
FMO1 Polyclonal Antibody
Catalog # :
PA5-95285
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human FMO1 (334-363aa AFPFLDESVVKVEDGQASLYKYIFPAHLQK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
dimethylaniline monooxygenase [N-oxide-forming] 1; Dimethylaniline oxidase 1; fetal hepatic flavin-containing monooxygenase 1; flavin containing dimethylaniline monoxygenase 1; flavin containing monooxygenase 1; Flavin-containing monooxygenase 1; Flavin-containing monooxygenase 1 (fetal liver); FMO 1; FMO 1A1; FMO form 1; Fmo1; Fmo-1; hepatic flavin-containing monooxygenase (EC 1.14.13.8); hepatic flavin-containing monooxygenase (FMO); hepatic flavin-containing monooxygenase 1; monooxygenase (FMO) (EC 1.14.13.8); RFMO1A
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA