This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
EphB1 Polyclonal Antibody
catalog :
PA5-95283
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
EphB1 Polyclonal Antibody
Catalog # :
PA5-95283
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
EPHB1 is a receptor tyrosine kinase that belongs to the ephrin receptor family. Members of the Eph family of kinases play important roles in diverse biological processes including nervous system development, angiogenesis and neural synapsis formation and maturation. EphB1 and other ephB family members are type 1 membrane spanning proteins, comprised of immunoglobulin, fibronectin type III, and cysteine rich subdomains in the ecto domain, and the single uninterrupted cytoplasmic tyrosine kinase domain upstream of a carboxyterminal sterile alpha motif (SAM) domain. ephB family proteins bind ephrins of the B class, ligands that are also transmembrane spanning proteins capable of transmitting signals. ephB1 is expressed predominantly in developing neural structures in embryos, and in vascular epithelium of kidney, and other tissues. Upon binding to alternatively oligomerized ephrin B1, ephB1 signals regulation of cell attachment and cellcell assembly. Members of this protein family are implicated in neuronal and vascular cell targeting.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human Eph receptor B1 (56-88aa RTYQVCNVFEPNQNNWLLTTFINRRGAHRIYTE).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
9330129L11; AW488255; C130099E04Rik; Cek6; EK6; ELK; Elkh; ELK-related protein tyrosine kinase; ENSMUSG00000074119; Eph receptor B1; Eph receptor B2 (ELK-related protein tyrosine kinase); eph tyrosine kinase 2; EPHB1; Ephb2; EPH-like kinase 6; Ephrin type-B receptor 1; EPHT2; Epth2; Erk; Hek6; NET; Neuronally-expressed EPH-related tyrosine kinase; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments