This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
Ku70 Polyclonal Antibody
catalog :
PA5-95270
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
Ku70 Polyclonal Antibody
Catalog # :
PA5-95270
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/ml, Immunohistochemistry (Paraffin): 0.5-1 ug/ml, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
XRCC6 is a nuclear complex consisting of two subunits with molecular masses of approximately 70 and 80 kDa. The complex functions as a single-stranded DNA-dependent ATP-dependent helicase. The complex may be involved in the repair of nonhomologous DNA ends such as that required for double-strand break repair, transposition, and V(D)J recombination. High levels of autoantibodies to p70 and p80 have been found in some patients with systemic lupus erythematosus.
Immunogen :
A synthetic peptide corresponding to a sequence at C-terminus of human Ku70 (464-496aa AIVEKLRFTYRSDSFENPVLQQHFRNLEALALD).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 0.5-1 ug/ml, Immunohistochemistry (Paraffin): 0.5-1 ug/ml, Western Blot: 0.1-0.5 ug/mL
Aliases :
5'-deoxyribose-5-phosphate lyase Ku70; 5'-dRP lyase Ku70; 5'-dRP/AP lyase Ku70; 70 kDa subunit of Ku antigen; 70kDa; ATP-dependent DNA helicase 2 subunit 1; ATP-dependent DNA helicase II 70 kDa subunit; ATP-dependent DNA helicase II, 70 kDa subunit; CT; CTA-216E10.7; CTC box binding factor 75 kDa subunit; CTC box-binding factor 75 kDa subunit; CTC75; CTCBF; DNA repair protein XRCC6; G22p1; Ku autoantigen p70 subunit; ku autoantigen protein p70 homolog; Ku autoantigen, 70kDa; Ku p70; Ku70; Ku70 DNA-binding component of DNA-dependent proteinkinase complex (thyroid autoantigen 70 kDa); Kup70; Lupus Ku autoantigen protein p70; ML8; OTTHUMP00000028581; thyroid autoantigen; thyroid autoantigen 70 kDa; thyroid autoantigen 70kD (Ku antigen); thyroid autoantigen 70kDa (Ku antigen); Thyroid-lupus autoantigen; thyroid-lupus autoantigen p70; TLAA; XELAEV_18023498mg; X-ray repair complementing defective repair in Chinese hamster cells 6; X-ray repair complementing defective repair in Chinese hamster cells 6 L homeolog; X-ray repair cross complementing 6; X-ray repair cross-complementing protein 6; xrcc6; xrcc6.L
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA