This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
STING Polyclonal Antibody
catalog :
PA5-95268
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
STING Polyclonal Antibody
Catalog # :
PA5-95268
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
STING is a 379 amino acid containing signaling protein that acts as an important component of innate immune signaling. This signaling protein is able to activate both NF-kappa-B and IRF3 transcription pathways to induce expression of type I interferon (IFN-alpha and IFN-beta) and exert a potent anti-viral state following expression. STING may have translocon function, the translocon possibly being able to influence the induction of type I interferons and is also involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) thus facilitating the detection of intracellular viral RNA species as well as B-form DNA and mediates death signaling via activation of the extracellular signal-regulated kinase (ERK) pathway. Generally seen in endoplasmic reticulum membrane, cell membrane and mitochondrion outer membrane, it is ubiquitously expressed in most of tissues.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human TMEM173 (284-316aa RLEQAKLFCRTLEDILADAPESQNNCRLIAYQE).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
2610307O08Rik; endoplasmic reticulum IFN stimulator; endoplasmic reticulum interferon stimulator; ERIS; hMITA; hSTING; hypothetical LOC533661; mediator of IRF3 activation; Mita; mitochondrial mediator of IRF3 activation; mitochondrial transmembrane protein 173; MMITA; Mpys; mSTING; NET23; N-terminal methionine-proline-tyrosine-serine plasma membrane tetraspanner; poSTING; RGD1562552; rSTING; SAVI; Stimulator of interferon genes protein; stimulator of interferon response cGAMP interactor 1; STING; STING1; tm173; Tmem173; Transmembrane protein 173
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
