This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SOX5 Polyclonal Antibody
catalog :
PA5-95266
quantity :
100 ug
price :
US 454.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, pigs
application :
western blot
citations: 1
product information
Product Type :
Antibody
Product Name :
SOX5 Polyclonal Antibody
Catalog # :
PA5-95266
Quantity :
100 ug
Price :
US 454.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Porcine, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Porcine, Rat
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SOX5 (495-528aa EKEKTTLESLTQQLAVKQNEEGKFSHAMMDFNLS).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
A730017D01Rik; AI528773; LAMSHF; L-SOX5; L-SOX5B; L-SOX5F; MGC35153; Sox5; Sox-5; Sox5-BLM isoform; Sox5l1; SRY (sex determining region Y)-box 5; SRY box 5; SRY-box 5; SRY-box containing gene 5; SRY-box containing gene 5-like 1; SRY-box transcription factor 5; SRY-related HMG-box 5 protein; transcription factor SOX-5
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
