This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD36 Polyclonal Antibody
catalog :
PA5-95242
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
CD36 Polyclonal Antibody
Catalog # :
PA5-95242
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
CD36, also known as scavenger receptor class B member 3, is a protein that is expressed on the surface of various cell types, including macrophages, platelets, and adipocytes. It plays a role in lipid metabolism, inflammation, and atherosclerosis, and is involved in the recognition and uptake of various ligands such as oxidized low-density lipoproteins, long-chain fatty acids, and apoptotic cells. CD36 is also implicated in the pathogenesis of malaria. The protein encoded by this gene serves as a receptor for thrombospondin in platelets and various cell lines, and is the fourth major glycoprotein of the platelet surface. It binds to collagen, thrombospondin, anionic phospholipids, and oxidized LDL, and directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. Diseases associated with CD36 include Platelet Glycoprotein IV Deficiency and Coronary Heart Disease 7.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
adipocyte membrane protein; BDPLT10; Cd36; CD36 antigen; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule; CD36 molecule (thrombospondin receptor); CD36 protein; CHDS7; cluster determinant 36; collagen type I receptor thrombospondin receptor; collagen type I receptor, thrombospondin receptor; FAT; FAT/CD36; fatty acid translocase; fatty acid translocase/CD36; fatty acid transport protein; glycoprotein IIIb; GP3B; GP4; GPIIIB; GPIV; I79_011940; Leukocyte differentiation antigen CD36; PAS IV; PAS4; PAS-4; PAS-4 protein; PASIV; Platelet collagen receptor; Platelet glycoprotein 4; platelet glycoprotein IV; Scarb3; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA