This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
BMI-1 Polyclonal Antibody
catalog :
PA5-95197
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
BMI-1 Polyclonal Antibody
Catalog # :
PA5-95197
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Bmi1 (135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
AW546694; B lymphoma Mo-MLV insertion region 1; B lymphoma Mo-MLV insertion region 1 homolog; Bmi1; Bmi-1; BMI1 polycomb ring finger oncogene; BMI1 polycomb ring finger proto-oncogene; BMI1 proto-oncogene, polycomb ring finger; FLVI2/BMI1; flvi-2/bmi-1; murine leukemia viral (bmi-1) oncogene homolog; Pcgf4; Pcgf4 antibody; Polycomb complex protein BMI-1; polycomb group protein Bmi1; polycomb group ring finger 4; polycomb group RING finger protein 4; RING finger protein 51; RNF51; RP11-573G6.1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA