ACTH Polyclonal Antibody | Invitrogen PA5-95177 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

ACTH Polyclonal Antibody

catalog :

PA5-95177

quantity :

100 ug

price :

US 474.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

ACTH Polyclonal Antibody

Catalog # :

PA5-95177

Quantity :

100 ug

Price :

US 474.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF).

Format :

Lyophilized

Applications w/Dilutions :

Immunohistochemistry (Paraffin): 0.5-1 ug/mL

Aliases :

ACTH; adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alphaMSH; alpha-MSH; BE; beta-endorphin; Beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; Clip; Corticotropin; Corticotropin-like intermediary peptide; corticotropin-lipotropin; Gamma-LPH; gamma-MSH; Lipotropin beta; lipotropin gamma; LPH; Melanocyte-stimulating hormone alpha; Melanocyte-stimulating hormone beta; Melanotropin alpha; melanotropin beta; Melanotropin gamma; met-enkephalin; MSH; NPP; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POC; Pomc; Pomc1; Pomc-1; Pomc2; Potential peptide; Precursor of MSH; pro-ACTH-endorphin; proopiomelanocortin; pro-opiomelanocortin; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); pro-opiomelanocortin-alpha; proopoimelanocortin, beta (endorphin, beta)