This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CD18 Polyclonal Antibody
catalog :
PA5-94946
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
product information
Product Type :
Antibody
Product Name :
CD18 Polyclonal Antibody
Catalog # :
PA5-94946
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human
Species :
Human
Isotype :
IgG
Storage :
Store at 4 C short term. For long term storage, store at -20 C, avoiding freeze/thaw cycles.
Description :
CD18 integrin beta 2 subunit is a 90 kDa type I transmembrane protein expressed on all leucocytes. CD18 can combine with integrin molecules CD11a-c to form heterodimers at the cell surface, and these heterodimers are known to participate in the process of cell adhesion as well as cell-surface mediated signaling. CD18 forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits, and these integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1, severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis. Defects in the CD18 gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the CD18 protein have been identified.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD).
Format :
Lyophilized
Aliases :
2E6; AI528527; antigen CD18; B-2 integrin; CD18; CD18 leukocyte adhesion molecule; CD18 subunit; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; complement receptor C3 subunit beta; integrin beta 2; integrin beta chain, beta 2; integrin beta-2; integrin subunit beta 2; integrin, beta 2; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; integrin, beta 2 (antigen CD18 (p95), lymphocyte function-associated antigen 1; macrophage antigen 1 (mac-1) beta subunit); integrin, beta 2 (antigen CD18 subunit (p95), lymphocyte function-associated antigen 1, integrin B2); integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); ITGB2; LAD; LCAMB; Leu-CAM receptor; leukocyte cell adhesion molecule CD18; leukocyte surface protein; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C; Lfa1; LFA-1; lymphocyte function associated antigen 1; MAC-1; Mac-1 beta; macrophage antigen 1 (mac-1) beta subunit); macrophage antigen-1 beta; MF17; MFI7
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments