This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
H-Ras Polyclonal Antibody
catalog :
PA5-94930
quantity :
100 ug
price :
US 464.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
H-Ras Polyclonal Antibody
Catalog # :
PA5-94930
Quantity :
100 ug
Price :
US 464.00
Clonality :
Polyclonal
Purity :
Affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Monomeric G protein Ras functions as a molecular switch linking receptor and nonreceptor tyrosine kinase activation to a number of downstream signaling pathways leading to distinct cytoplasmic or nuclear events. Each mammalian cell contains three Ras proto-oncogene coding for closely related Ras proteins: H-, K-, N-Ras. Oncogenic mutations in Ras genes are present in ~30% of all human cancers. Constitutive activation of Ras due to mutations or overexpression stimulates proliferation and inhibition of apoptosis. K-Ras mutations are common in pancreatic, colorectal and nonsmall-cell lung carcinomas; H-Ras mutations are common in bladder, kidney and thyroid carcinomas; N-Ras mutations are found in melanoma, hematological malignancies and hepatocellular carcinaoma.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human GTPase HRAS (101-137aa KRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLAR SY).
Format :
Lyophilized
Applications w/Dilutions :
Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
C-BAS/HAS; c-Ha-ras; c-Ha-ras p21 protein; c-Ha-ras transgene; C-HA-RAS1; c-has/bas p21 protein; c-H-ras; c-rasHa; c-ras-Ki-2 activated oncogene; CTLO; GTP- and GDP-binding peptide B; GTPase HRas; GTPase HRas, N-terminally processed; GTPase Hras1; HAMSV; Ha-ras; Ha-Ras1 proto-oncoprotein; Harvey ras1 protein; Harvey rat sarcoma viral (v-Ha-ras) oncogene homolog; Harvey rat sarcoma viral oncogene homolog; Harvey rat sarcoma viral oncoprotein; Harvey rat sarcoma virus oncogene; Harvey rat sarcoma virus oncogene 1; Harvey-ras; Hras; H-ras; H-ras 1 protein; HRas proto-oncogene, GTPase; HRAS1; H-Ras-1; Hras-1; H-RASIDX; Kras2; p19 H-RasIDX protein; p21ras; ras; Ras family small GTP binding protein H-Ras; ras p21; RASH1; transformation gene: oncogene HAMSV; transforming protein P21; v-Ha-ras Harvey rat sarcoma viral oncogene homolog
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA