Osteopontin Polyclonal Antibody | Invitrogen PA5-94926 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

Osteopontin Polyclonal Antibody

catalog :

PA5-94926

quantity :

100 ug

price :

US 454.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, ELISA

product information

Product Type :

Antibody

Product Name :

Osteopontin Polyclonal Antibody

Catalog # :

PA5-94926

Quantity :

100 ug

Price :

US 454.00

Clonality :

Polyclonal

Purity :

Affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Osteopontin is an arginine-glycine-aspartic acid (RGD)-containing glycoprotein that interacts with integrins and CD44 as major receptors. It is a multifunctional protein involved in bone mineralization, cell adhesion, cell migration, chronic inflammatory disease and transformation. Proteolytic cleavage by thrombin and matrix metalloproteinases close to the integrin-binding Arg-Gly-Asp sequence modulates the function of OPN and its integrin binding properties. Thrombin-cleaved fragments of Osteopontin are overexpressed in malignant glial tumors and provide a molecular niche with survival advantage and provide a novel substrate for plasmin and cathepsin D.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN).

Format :

Lyophilized

Applications w/Dilutions :

ELISA: 0.1-0.5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

2AR; 2b7; 44 kDa bone phosphoprotein; Apl-1; BNSP; Bone sialoprotein 1; Bone sialoprotein 1 (BSPI/BSP1); Bsp; BSPI; Calcium oxalate crystal growth inhibitor protein; CALPHA1 fusion; Early T lymphocyte activation 1 (ETA1); early T-lymphocyte activation 1; early T-lymphocyte activation 1 protein; Eta; ETA-1; HGNC:11255; immunoglobulin alpha 1 heavy chain constant region fusion protein; MGC110940; Minopontin; nephropontin; Op; Opn; Opnl; OSP; osteopontin; osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein; osteopontin-like protein; PSEC0156; Ric; Secreted phosphoprotein 1; secreted phosphoprotein 1 (osteopontin bone sialoprotein I early T lymphocyte activation 1); secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1); Secreted phosphoprotein 1 (SPP1); secreted phosphoprotein 1 variant 6; Sialoprotein (osteopontin); SPP1; SPP-1; SPP1/CALPHA1 fusion; unnamed protein product; urinar; urinary stone protein; Uropontin