This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
14-3-3 zeta Polyclonal Antibody
catalog :
PA5-80245
quantity :
100 ug
price :
US 424.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
14-3-3 zeta Polyclonal Antibody
Catalog # :
PA5-80245
Quantity :
100 ug
Price :
US 424.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Non-human primate, Rat
Applications :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Non-human primate, Rat
Isotype :
IgG
Storage :
-20 C
Description :
At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
Immunogen :
(LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDD
KKGIVDQ).
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta
KKGIVDQ).
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
1110013I11Rik; 14-3-3 delta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 14-3-3z; 14-3-3zeta; 14-3-3-zeta; 143Z; AI596267; AL022924; AU020854; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; factor activating exoenzyme S; FAS; HEL4; HEL-S-3; HEL-S-93; KCIP-1; mitochondrial import stimulation factor S1 subunit; Msfs1; phospholipase A2; protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5-monooxygenase activation protein zeta polypeptide; tyrosine 3-monooxygenase tryptophan 5-monooxygenase activation protein; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; YWHAD; YWHAZ
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments