WNT7A Polyclonal Antibody | Invitrogen PA5-80231 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

WNT7A Polyclonal Antibody

catalog :

PA5-80231

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry

citations: 1

Reference
Torres V, Barrera D, Varas Godoy M, Arancibia D, Inestrosa N. Selective Surface and Intraluminal Localization of Wnt Ligands on Small Extracellular Vesicles Released by HT-22 Hippocampal Neurons. Front Cell Dev Biol. 2021;9:735888 pubmed publisher

product information

Product Type :

Antibody

Product Name :

WNT7A Polyclonal Antibody

Catalog # :

PA5-80231

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Wnt-7a belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. It is expressed in placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain. Most Wnt proteins can signal though a mechanism called the canonical Wnt pathway, in which Wnt proteins bind to and activate seven-pass transmembrane receptors of the Frizzled family, ultimately leading to the disruption of ß-catenin degradation. Intracellular accumulation of ß-catenin increases translocation of the protein into the nucleus, where it binds to TCF/LEF transcription factors to induce the expression of numerous genes. Increased Wnt/ß-catenin signaling is associated with tumorigenesis in a diverse set of human cancers. However, Wnt-7a/Frizzled-9 signaling has been shown to act as a tumor suppressor in non-small cell lung cancers.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Western Blot: 0.1-0.5 ug/mL

Aliases :

AI849442; postaxial hemimelia; protein Wnt-7a; proto-oncogene Wnt7a protein; px; tw; wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family member 7A; wingless-type MMTV integration site family, member 7A; Wnt family member 7A; WNT7A; Wnt-7a