This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
VRK1 Polyclonal Antibody
catalog :
PA5-80222
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
VRK1 Polyclonal Antibody
Catalog # :
PA5-80222
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Rat
Isotype :
IgG
Storage :
-20 C
Description :
Human vaccinia-related kinase 1 (VRK1) is a new kinase related to a poxvirus kinase, and more distantly to the casein kinase 1 family. VRK1 shows strong autophosphorylating activity in several Ser and Thr residues. VRK has also been found to be an upstream regulator of p53 that belongs to a new signaling pathway.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
51PK; MGC117401; MGC138280; PCH1; PCH1A; Serine/threonine-protein kinase 51PK; serine/threonine-protein kinase VRK1; vaccinia related kinase 1; vaccinia virus B1R-related kinase 1; vaccinia-related kinase 1; VRK1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments