UPF1 Polyclonal Antibody | Invitrogen PA5-80208 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

UPF1 Polyclonal Antibody

catalog :

PA5-80208

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

UPF1 Polyclonal Antibody

Catalog # :

PA5-80208

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Upf1 was identified as an active component in nonsense-mediated decay (NMD), an mRNA surveillance mechanism in eukaryotic cells that degrades mRNAs containing premature termination codons. Upf1 was found to be an ATP-dependent RNA helicase in the cytoplasm and was later shown to be a component of cytoplasmic P-bodies. Upf1 phosphorylation mediates the repression of translation that accompanies NMD, allowing mRNA accessibility to the NMD machinery. Two other active components of NMD, Upf2 and Upf3, were also identified and described as having perinuclear and nucleocytoplasmic localization, respectively.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human RENT1/hUPF1 (578-614aa NMDSMPELQKLQQLKDETGELSSADEKRYRALKRT AE).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

ATP-dependent helicase RENT1; B430202H16Rik; delta helicase; FLJ43809; FLJ46894; HUPF1; KIAA0221; LOW QUALITY PROTEIN: regulator of nonsense transcripts 1; mUpf1; Nonsense mRNA reducing factor 1; NORF1; pNORF1; PNORF-1; Regulator of nonsense transcripts 1; Regulator of nonsense transcripts 1 (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog); Rent1; smg-2; smg-2 homolog, nonsense mediated mRNA decay factor; Upf1; UPF1 regulator of nonsense transcripts homolog; UPF1 regulator of nonsense transcripts homolog (yeast); UPF1 RNA helicase and ATPase; UPF1, RNA helicase and ATPase; Upflp; up-frameshift mutation 1 homolog; up-frameshift suppressor 1 homolog; wu:fi40f07; wu:fj48a01; yeast Upf1p homolog; zgc:55472