This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
UHRF1 Polyclonal Antibody
catalog :
PA5-80205
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
UHRF1 Polyclonal Antibody
Catalog # :
PA5-80205
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ).
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
Ac2-121; AL022808; E3 ubiquitin-protein ligase UHRF1; fb97f09; FLJ21925; hNP95; Hnp95 Huhrf1; hUHRF1; HuNp95; ICBP90; inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; mUhrf1; Np95; nuclear phosphoprotein 95; nuclear protein; nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RING-type E3 ubiquitin transferase UHRF1; RNF106; TDRD22; transcription factor ICBP90; ub; ubiquitin like with PHD and ring finger domains 1; ubiquitin-like PHD and RING finger domain-containing protein 1; ubiquitin-like with PHD and ring finger domains 1; ubiquitin-like, containing PHD and RING finger domains, 1; ubiquitin-like-containing PHD and RING finger domains protein 1; Uhrf1; unm b1115; unm_b1115; wu:fb97f09; zgc:63539
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com
800-678-5599
headquarters: USA