This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
UBE2Q2 Polyclonal Antibody
catalog :
PA5-80202
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
UBE2Q2 Polyclonal Antibody
Catalog # :
PA5-80202
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human
Applications :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human
Isotype :
IgG
Storage :
-20 C
Description :
Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. [UniProt]
Immunogen :
LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEML
DQ).
A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa
DQ).
A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa
Format :
Lyophilized
Applications w/Dilutions :
Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 2 ug/mL, Immunohistochemistry (Paraffin): 0.5-1 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
3010021M21Rik; DKFZp762C143; E2 ubiquitin-conjugating enzyme Q2; RGD1307680; UBE2Q2; Ubiquitin carrier protein Q2; ubiquitin conjugating enzyme E2 Q2; ubiquitin conjugating enzyme E2Q family member 2; ubiquitin conjugating enzyme-implantation induced; ubiquitin-conjugating enzyme E2 Q2; ubiquitin-conjugating enzyme E2Q (putative) 2; ubiquitin-conjugating enzyme E2Q 2; ubiquitin-conjugating enzyme E2Q family member 2; ubiquitin-conjugating enzyme UBCi; Ubiquitin-protein ligase Q2; Unknown (protein for MGC:134315); wu:fi34a03; zgc:56219
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
