beta-5 Tubulin Polyclonal Antibody | Invitrogen PA5-80198 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

beta-5 Tubulin Polyclonal Antibody

catalog :

PA5-80198

quantity :

100 ug

price :

US 424.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, chicken

application :

western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

Product Type :

Antibody

Product Name :

beta-5 Tubulin Polyclonal Antibody

Catalog # :

PA5-80198

Quantity :

100 ug

Price :

US 424.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Chicken, Human, Mouse, Non-human primate, Rat

Applications :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Species :

Chicken, Human, Mouse, Non-human primate, Rat

Isotype :

IgG

Storage :

-20 C

Description :

Microtubules, the major cytoskeletal elements found in all eukaryotic cells, consist of Tublin, which is a dimer of two 55kDa subunits: alpha and Beta. Microtubules play key roles in chromosome segregation in mitosis, intracellular transport, ciliary and flagellar bending, and structural support of the cytoskeleton. This antibody does not cause the 10-nm filaments to collapse into large lateral aggregates collecting in the cell periphery or tight juxtanuclear caps. It does not block microtubule assembly. Ab-3 does not inhibit polymerization or depolymerization of platelet tubulin in vitro. It blocks (by 70-80%) the ability of tubulin dimers (with GppNHp bound) to promote a stable inhibition of adenylyl cyclase.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE).

Format :

Lyophilized

Applications w/Dilutions :

Flow Cytometry: 1-3 ug/1x10^6 cells, Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL

Aliases :

AA408537; AI596182; B130022C14Rik; beta Ib tubulin; CDCBM6; CSCSC1; M(beta)5; M40; OK/SW-cl.56; tbb5; TUBB; TUBB1; TUBB5; tubulin beta; Tubulin beta chain; tubulin beta class I; tubulin beta-1 chain; tubulin beta-5 chain; tubulin, beta 5 class I; tubulin, beta class I; tubulin, beta polypeptide