This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
DR4 Polyclonal Antibody
catalog :
PA5-80143
quantity :
100 ug
price :
US 410.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry
product information
Product Type :
Antibody
Product Name :
DR4 Polyclonal Antibody
Catalog # :
PA5-80143
Quantity :
100 ug
Price :
US 410.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
TRAIL-R1 (CD261, DR4) is a type I transmembrane protein, also called TRAIL receptor 1. The ligand for this DR4 death receptor has been identified and termed TRAIL, which is a member of the TNF family. DR4, as many other receptors (Fas, TNFR1, etc.), mediates apoptosis and NF kappaB activation in many cells and tissues. Apoptosis, a programmed cell death, is a operating process in normal cellular differentiation and development of multicellular organisms. Apoptosis is induced by coupled of certain cytokines (TNF family - TNF, Fas ligand) and their death domain containing receptors (TNFR1, Fas receptor).
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
APO2; CD261; cytotoxic TRAIL receptor; death receptor 4; DR4; MGC9365; sCD261; soluble CD261; soluble TRAIL; sTRAIL; TNF receptor superfamily member 10a; TNF-related apoptosis-inducing ligand receptor 1; TNFRSF10A; TRAIL R1; TRAIL receptor 1; TRAILR1; TRAIL-R1; TRAILR-1; tumor necrosis factor receptor superfamily member 10A; tumor necrosis factor receptor superfamily member 10a variant 2; tumor necrosis factor receptor superfamily, member 10a
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments