This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
TCP1 Polyclonal Antibody
catalog :
PA5-80100
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
Product Type :
Antibody
Product Name :
TCP1 Polyclonal Antibody
Catalog # :
PA5-80100
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS).
Format :
Lyophilized
Applications w/Dilutions :
Immunocytochemistry: 5 ug/mL, Immunohistochemistry (Paraffin): 2-5 ug/mL, Western Blot: 0.1-0.5 ug/mL
Aliases :
65 kDa antigen; AI528772; c-cpn; CCT; Cct1; Ccta; CCTalpha; CCT-alpha; chaperonin-containing T-complex alpha subunit TCP1; chaperonin-containing T-complex polypeptide alpha subunit; cytosolic chaperonin containing t-complex polypeptide 1; D6S230E; hypothetical protein; p63; tailless complex polypeptide 1; tailless complex polypeptide 1A; Tailless complex polypeptide 1B; t-complex 1; t-complex polypeptide 1; t-complex protein 1; T-complex protein 1 alpha subunit-like protein; T-complex protein 1 subunit alpha; T-complex protein 1 subunit alpha A; T-complex protein 1 subunit alpha B; T-complex protein 1, alpha subunit; Tcp1; Tcp-1; TCP-1-A; TCP-1-alpha; TCP-1-B; Tp63; TRic; Unknown (protein for MGC:133746); YD8142.13; YD8142B.04; YDR212W
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments