SMAD1/SMAD5 Polyclonal Antibody | Invitrogen PA5-80036 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Invitrogen

other brands :

NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience

product type :

antibody

product name :

SMAD1/SMAD5 Polyclonal Antibody

catalog :

PA5-80036

quantity :

100 ug

price :

US 404.00

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

citations: 3

Reference
Cussonneau L, Coudy Gandilhon C, Deval C, Chaouki G, Djelloul Mazouz M, Delorme Y, et al. Induction of ATF4-Regulated Atrogenes Is Uncoupled from Muscle Atrophy during Disuse in Halofuginone-Treated Mice and in Hibernating Brown Bears. Int J Mol Sci. 2022;24: pubmed publisher
Cussonneau L, Boyer C, Brun C, Deval C, Loizon E, Meugnier E, et al. Concurrent BMP Signaling Maintenance and TGF-β Signaling Inhibition Is a Hallmark of Natural Resistance to Muscle Atrophy in the Hibernating Bear. Cells. 2021;10: pubmed publisher
Ma X, Yang J, Liu T, Li J, Lan Y, Wang Y, et al. Gukang Capsule Promotes Fracture Healing by Activating BMP/SMAD and Wnt/β-Catenin Signaling Pathways. Evid Based Complement Alternat Med. 2020;2020:7184502 pubmed publisher

product information

Product Type :

Antibody

Product Name :

SMAD1/SMAD5 Polyclonal Antibody

Catalog # :

PA5-80036

Quantity :

100 ug

Price :

US 404.00

Clonality :

Polyclonal

Purity :

Antigen affinity chromatography

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Applications :

Western Blot: 0.1-0.5 ug/mL

Species :

Human, Mouse, Rat

Isotype :

IgG

Storage :

-20 C

Description :

The Smad family of proteins are functioning in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of a TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 is then able to form a complex with Smad4. These complexes accumulate in the cell nucleus, where they are directly participating in the regulation of gene expression. In mammals, eight Smad proteins have been identified to date. The Smad family of proteins can be divided into three functional groups: the receptor-activated Smads (R-Smads), common mediator Smads (Co-Smads), and the inhibitory Smads (I-Smads). The R-Smads are directly phosphorylated by the activated type I receptors on their C-terminal Ser-Ser-X-Ser (SSXS) motif and include Smad1, Smad2, Smad3, Smad5, and Smad8. Smad2 and Smad3 are phosphorylated in response to TGF-beta and activin, whereas Smad1, Smad5, and Smad8 are phosphorylated in response to BMP (Bone Morphogenetic Protein). This C-terminal phosphorylation allows R-Smad binding to Co-Smad, Smad4, and translocation to the nucleus where they regulate TGF-beta target genes. Smad6 and Smad7 belong to the I-Smad which bind to the type I receptor or Smad4 and block their interaction with R-Smads.

Immunogen :

A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK).

Format :

Lyophilized

Applications w/Dilutions :

Western Blot: 0.1-0.5 ug/mL

Aliases :

1110051M15Rik; AI451355; AI528653; BSP1; BSP-1; dwarfin-A; Dwarfin-C; dwf-A; DWFC; Dwf-C; hSMAD1; hSmad5; JV41; JV4-1; JV5-1; MAD (mothers against decapentaplegic, Drosophila) homolog 1; MAD homolog 1; MAD homolog 5; MAD homolog1 (mothers against decapentaplegic, Drosophila); MAD, mothers against decapentaplegic homolog 1; MAD, mothers against decapentaplegic homolog 5; Madh1; Madh5; Madr1; mad-related protein 1; Mlp1; mMad1; mothers against decapentaplegic homolog 1; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; mothers against DPP homolog 1; mothers against DPP homolog 5; mothers-against-DPP-related 1; Msmad5; MusMLP; OTTHUMP00000223331; SMA- and MAD-related protein 5; SMAD; Smad 1; SMAD 5; SMAD family member 1; SMAD family member 5; SMAD, mothers against DPP homolog 1; SMAD, mothers against DPP homolog 5; SMAD1; SMAD5; TGF-beta signaling protein 1; transforming growth factor-beta signaling protein 1; Transforming growth factor-beta-signaling protein 1