This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
SMAD1/SMAD5 Polyclonal Antibody
catalog :
PA5-80036
quantity :
100 ug
price :
US 404.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
citations: 3
| Reference |
|---|
product information
Product Type :
Antibody
Product Name :
SMAD1/SMAD5 Polyclonal Antibody
Catalog # :
PA5-80036
Quantity :
100 ug
Price :
US 404.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The Smad family of proteins are functioning in the transmission of extracellular signals in the TGF-beta signaling pathway. Binding of a TGF-beta superfamily ligands to extracellular receptors triggers phosphorylation of Smad2 at a Serine-Serine-Methionine-Serine (SSMS) motif at its C-terminus. Phosphorylated Smad2 is then able to form a complex with Smad4. These complexes accumulate in the cell nucleus, where they are directly participating in the regulation of gene expression. In mammals, eight Smad proteins have been identified to date. The Smad family of proteins can be divided into three functional groups: the receptor-activated Smads (R-Smads), common mediator Smads (Co-Smads), and the inhibitory Smads (I-Smads). The R-Smads are directly phosphorylated by the activated type I receptors on their C-terminal Ser-Ser-X-Ser (SSXS) motif and include Smad1, Smad2, Smad3, Smad5, and Smad8. Smad2 and Smad3 are phosphorylated in response to TGF-beta and activin, whereas Smad1, Smad5, and Smad8 are phosphorylated in response to BMP (Bone Morphogenetic Protein). This C-terminal phosphorylation allows R-Smad binding to Co-Smad, Smad4, and translocation to the nucleus where they regulate TGF-beta target genes. Smad6 and Smad7 belong to the I-Smad which bind to the type I receptor or Smad4 and block their interaction with R-Smads.
Immunogen :
A synthetic peptide corresponding to a sequence of human SMAD1/SMAD5 (KRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEK).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
1110051M15Rik; AI451355; AI528653; BSP1; BSP-1; dwarfin-A; Dwarfin-C; dwf-A; DWFC; Dwf-C; hSMAD1; hSmad5; JV41; JV4-1; JV5-1; MAD (mothers against decapentaplegic, Drosophila) homolog 1; MAD homolog 1; MAD homolog 5; MAD homolog1 (mothers against decapentaplegic, Drosophila); MAD, mothers against decapentaplegic homolog 1; MAD, mothers against decapentaplegic homolog 5; Madh1; Madh5; Madr1; mad-related protein 1; Mlp1; mMad1; mothers against decapentaplegic homolog 1; Mothers against decapentaplegic homolog 5; mothers against decapentaplegic, drosophila, homolog of, 5; mothers against DPP homolog 1; mothers against DPP homolog 5; mothers-against-DPP-related 1; Msmad5; MusMLP; OTTHUMP00000223331; SMA- and MAD-related protein 5; SMAD; Smad 1; SMAD 5; SMAD family member 1; SMAD family member 5; SMAD, mothers against DPP homolog 1; SMAD, mothers against DPP homolog 5; SMAD1; SMAD5; TGF-beta signaling protein 1; transforming growth factor-beta signaling protein 1; Transforming growth factor-beta-signaling protein 1
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments
