This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Invitrogen
other brands :
NeoMarkers, Lab Vision, Endogen, Pierce, BioSource International, Zymed Laboratories, Caltag, Molecular Probes, Research Genetics, Life Technologies, Applied Biosystems, GIBCO BRL, ABgene, Dynal, Affinity BioReagents, Nunc, Invitrogen, NatuTec, Oxoid, Richard-Allan Scientific, Arcturus, Perseptive Biosystems, Proxeon, eBioscience
product type :
antibody
product name :
CTR1 Polyclonal Antibody
catalog :
PA5-80029
quantity :
100 ug
price :
US 400.00
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
Product Type :
Antibody
Product Name :
CTR1 Polyclonal Antibody
Catalog # :
PA5-80029
Quantity :
100 ug
Price :
US 400.00
Clonality :
Polyclonal
Purity :
Antigen affinity chromatography
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Applications :
Western Blot: 0.1-0.5 ug/mL
Species :
Human, Mouse, Rat
Isotype :
IgG
Storage :
-20 C
Description :
The trace metal copper (Cu) plays a crucial role in mammalian cells as a cofactor for many enzymes. Cu-related genetic diseases, such as Menkes disease and Wilson disease, arise from a lack of Cu homeostasis in mammalian cells. CTR1 is a high-affinity copper-uptake protein. The C-terminal domain is similar to the Raf family of protein kinases, but it's first two-thirds encodes a novel protein domain. CTR1 provides the primary avenue for copper uptake in mammalian cells, thereby, affecting Cu homeostasis and embryonic development.
Immunogen :
A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).
Format :
Lyophilized
Applications w/Dilutions :
Western Blot: 0.1-0.5 ug/mL
Aliases :
4930445G01Rik; AI787263; AU016967; copper transport 1 homolog; copper transporter 1; Copper uptake transporter 1; COPT1; ctr1; ctr-1; hCTR1; high affinity copper uptake protein; high affinity copper uptake protein 1; high-affinity copper uptake protein; liver regeneration-related protein LRRGT00200; LRRGT00200; rCTR1; SLC31A1; slc31a1.L; solute carrier family 13 (sodium/sulphate symporters), member 1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporter), member 1 L homeolog; solute carrier family 31 (copper transporters), member 1; solute carrier family 31 member 1; solute carrier family 31, member 1; Xctr1; XELAEV_18038194mg; zgc:76839
company information
Invitrogen
Thermo Fisher Scientific
81 Wyman Street
Waltham, MA USA 02451
https://www.thermofisher.com81 Wyman Street
Waltham, MA USA 02451
800-678-5599
headquarters: USA
questions and comments